Description
Khinkali is a Georgian dumpling with a wheat‑based dough and a spiced meat filling.
Technical
The dough relies on gluten network formation for elasticity, while the filling undergoes protein denaturation during boiling. Precise temperature control ensures starch gelatinization just enough to hold the shape, and proper sealing prevents steam‑induced rupture.
Science
Primary Reaction
Protein denaturation, starch gelatinization, gluten network formation
Sensory Profile
Aroma ()
savorymeatyherbalyeastywarmspicedearthygarlickyonionyfreshly ground pepper